SLC1A5 anticorps

N° du produit ABIN630342

Détail du produit anti-SLC1A5 anticorps

Antigène: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC1A5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC1A5 Blocking Peptide, catalog no. 33R-2915, is also available for use as a blocking control in assays to test for specificity of this SLC1A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-SLC1A5 (ABIN630342)

Krämer, Gröner, Hoffmann, Craig, Brugger, Drzezga, Timmer, Neumaier, Zlatopolskiy, Endepols, Neumaier: "Evaluation of 3-l- and 3-d-[18F]Fluorophenylalanines as PET Tracers for Tumor Imaging." dans: Cancers, Vol. 13, Issue 23, (2021) (PubMed).

Détails sur SLC1A5

Antigène: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Autre désignation: SLC1A5 (SLC1A5 Produits)

Synonymes: anticorps aaat, anticorps asct2, anticorps atbo, anticorps m7v1, anticorps m7vs1, anticorps r16, anticorps rdrc, anticorps AAAT, anticorps ASCT2, anticorps ATBO, anticorps M7V1, anticorps M7VS1, anticorps R16, anticorps RDRC, anticorps Slc1a7, anticorps Asct2, anticorps H4-ASCT2, anticorps solute carrier family 1 (neutral amino acid transporter), member 5, anticorps solute carrier family 1 member 5 S homeolog, anticorps solute carrier family 1 member 5, anticorps slc1a5, anticorps slc1a5.S, anticorps SLC1A5, anticorps Slc1a5

Sujet: SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport, L'effet Warburg