RNF121 anticorps (N-Term)

N° du produit ABIN630351

Détail du produit anti-RNF121 anticorps

Antigène: RNF121 (Ring Finger Protein 121 (RNF121))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF121 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RNF121 antibody was raised against the N terminal of RNF121

Purification: Purified

Immunogène: RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF121 Blocking Peptide, catalog no. 33R-10040, is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF121 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF121

Antigène: RNF121 (Ring Finger Protein 121 (RNF121))

Autre désignation: RNF121 (RNF121 Produits)

Synonymes: anticorps 4930544L10Rik, anticorps im:6907121, anticorps si:ch73-373k7.1, anticorps ring finger protein 121, anticorps RING finger protein 121, anticorps RNF121, anticorps rnf-121, anticorps Rnf121, anticorps rnf121

Sujet: The protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling