SMPD2 anticorps

N° du produit ABIN630382

Cet anticorps Lapin Polyclonal détecte spécifiquement SMPD2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour SMPD2 anticorps (ABIN630382)

Antigène: SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMPD2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SMPD2 anticorps

Purification: Purified

Immunogène: SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMPD2 Blocking Peptide, (ABIN5616305), is also available for use as a blocking control in assays to test for specificity of this SMPD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMPD2

Antigène: SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))

Autre désignation: SMPD2

Sujet: SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway