TMPRSS11D anticorps (N-Term)
-
- Antigène Voir toutes TMPRSS11D Anticorps
- TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMPRSS11D est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- TMPRSS11 D antibody was raised against the N terminal of TMPRSS11
- Purification
- Purified
- Immunogène
- TMPRSS11 D antibody was raised using the N terminal of TMPRSS11 corresponding to a region with amino acids RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA
- Top Product
- Discover our top product TMPRSS11D Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMPRSS11D Blocking Peptide, catalog no. 33R-8213, is also available for use as a blocking control in assays to test for specificity of this TMPRSS11D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))
- Autre désignation
- TMPRSS11D (TMPRSS11D Produits)
- Synonymes
- anticorps HAT, anticorps AST, anticorps AsP, anticorps BC020151, anticorps Asp, anticorps Tmprss11d, anticorps transmembrane protease, serine 11D, anticorps transmembrane protease, serine 11d, anticorps transmembrane protease serine 11D, anticorps TMPRSS11D, anticorps Tmprss11d, anticorps LOC100720850
- Sujet
- TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
- Poids moléculaire
- 46 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Regulation of Carbohydrate Metabolic Process
-