Melanoma gp100 anticorps

N° du produit ABIN630469

Cet anticorps Lapin Polyclonal détecte spécifiquement Melanoma gp100 dans IHC et WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour Melanoma gp100 anticorps (ABIN630469)

Antigène: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Melanoma gp100 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit anti-Melanoma gp100 anticorps

Purification: Purified

Immunogène: SILV antibody was raised using a synthetic peptide corresponding to a region with amino acids HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SILV Blocking Peptide, (ABIN939113), is also available for use as a blocking control in assays to test for specificity of this SILV antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SILV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Melanoma gp100

Antigène: Melanoma gp100 (PMEL) (Premelanosome Protein (PMEL))

Autre désignation: SILV

Sujet: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Poids moléculaire: 70 kDa (MW of target protein)