HNF4A anticorps (Middle Region)

N° du produit ABIN630607

Cet anticorps Lapin Polyclonal détecte spécifiquement HNF4A dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour HNF4A anticorps (Middle Region) (ABIN630607)

Antigène: HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNF4A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HNF4A anticorps

Épitope: Middle Region

Specificité: HNF4 A antibody was raised against the middle region of HNF4

Purification: Affinity purified

Immunogène: HNF4 A antibody was raised using the middle region of HNF4 corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNF4A Blocking Peptide, (ABIN5614035), is also available for use as a blocking control in assays to test for specificity of this HNF4A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNF4A

Antigène: HNF4A (Hepatocyte Nuclear Factor 4, alpha (HNF4A))

Autre désignation: HNF4A

Sujet: The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: AMPK Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, Cell-Cell Junction Organization, Regulation of Carbohydrate Metabolic Process