PDE9A anticorps (N-Term)
-
- Antigène Voir toutes PDE9A Anticorps
- PDE9A (phosphodiesterase 9A (PDE9A))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDE9A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PDE9 A antibody was raised against the N terminal of PDE9
- Purification
- Affinity purified
- Immunogène
- PDE9 A antibody was raised using the N terminal of PDE9 corresponding to a region with amino acids SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
- Top Product
- Discover our top product PDE9A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDE9A Blocking Peptide, catalog no. 33R-8356, is also available for use as a blocking control in assays to test for specificity of this PDE9A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDE9A (phosphodiesterase 9A (PDE9A))
- Autre désignation
- PDE9A (PDE9A Produits)
- Synonymes
- anticorps PDE9A, anticorps MGC116558, anticorps Pde9a, anticorps HSPDE9A2, anticorps PDE9A1, anticorps phosphodiesterase 9A, anticorps phosphodiesterase 9A S homeolog, anticorps high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, anticorps PDE9A, anticorps pde9a.S, anticorps Pde9a, anticorps LOC100549810, anticorps pde9a
- Sujet
- PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.
- Poids moléculaire
- 61 kDa (MW of target protein)
-