KPNA4 anticorps

N° du produit ABIN630664

Détail du produit anti-KPNA4 anticorps

Antigène: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPNA4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Karyopherin Alpha 4 Blocking Peptide, catalog no. 33R-4568, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KPNA4

Antigène: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Autre désignation: Karyopherin alpha 4 (KPNA4 Produits)

Synonymes: anticorps IPOA3, anticorps QIP1, anticorps SRP3, anticorps 6, anticorps ATIMPALPHA3, anticorps IMPA-3, anticorps IMPORTIN ALPHA 3, anticorps IMPORTIN ALPHA ISOFORM 3, anticorps MODIFIER OF SNC1, anticorps T10M13.16, anticorps T10M13_16, anticorps LOC100224013, anticorps 1110058D08Rik, anticorps importin, anticorps ipoa3, anticorps qip1, anticorps srp3, anticorps impa3, anticorps wu:fa56d07, anticorps wu:fa66g10, anticorps wu:fe14c04, anticorps wu:fi04h11, anticorps wu:fi19b05, anticorps karyopherin subunit alpha 4, anticorps ARM repeat superfamily protein, anticorps importin alpha 3, anticorps karyopherin (importin) alpha 4, anticorps karyopherin alpha 4 (importin alpha 3) S homeolog, anticorps karyopherin alpha 4 (importin alpha 3), anticorps KPNA4, anticorps MOS6, anticorps LOC100533341, anticorps Kpna4, anticorps kpna4.S, anticorps kpna4

Sujet: The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognise NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus