H2AFY anticorps (Middle Region)

N° du produit ABIN630687

Cet anticorps anti-H2AFY est un anticorps Lapin Polyclonal détectant H2AFY dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour H2AFY anticorps (Middle Region) (ABIN630687)

Antigène: H2AFY (H2A Histone Family, Member Y (H2AFY))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp H2AFY est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-H2AFY anticorps

Épitope: Middle Region

Specificité: H2 AFY antibody was raised against the middle region of H2 FY

Purification: Affinity purified

Immunogène: H2 AFY antibody was raised using the middle region of H2 FY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

H2AFY Blocking Peptide, (ABIN5613917), is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur H2AFY

Antigène: H2AFY (H2A Histone Family, Member Y (H2AFY))

Autre désignation: H2AFY

Sujet: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Poids moléculaire: 39 kDa (MW of target protein)