CENPA anticorps (Middle Region)
-
- Antigène Voir toutes CENPA Anticorps
- CENPA (Centromere Protein A (CENPA))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CENPA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CENPA antibody was raised against the middle region of CENPA
- Purification
- Affinity purified
- Immunogène
- CENPA antibody was raised using the middle region of CENPA corresponding to a region with amino acids ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
- Top Product
- Discover our top product CENPA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CENPA Blocking Peptide, catalog no. 33R-1362, is also available for use as a blocking control in assays to test for specificity of this CENPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CENPA (Centromere Protein A (CENPA))
- Autre désignation
- CENPA (CENPA Produits)
- Synonymes
- anticorps CENP-A, anticorps CenH3, anticorps Cenp-A, anticorps cenpx, anticorps cenp-a, anticorps sim2, anticorps Cenp-a, anticorps RGD1563607, anticorps CENPA, anticorps centromere protein A, anticorps centromere protein-A, anticorps centromeric histone-3 like protein, anticorps centromere-specific histone H3 CENP-A, anticorps cenp-A, anticorps centromere protein A L homeolog, anticorps histone H3-like centromeric protein A, anticorps CENPA, anticorps Cenpa, anticorps CENP-A, anticorps cenpa, anticorps cenp-A, anticorps cnp1, anticorps HAN_3g422, anticorps Cenp-a, anticorps cenpa.L, anticorps CMU_016480
- Sujet
- Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.
- Poids moléculaire
- 16 kDa (MW of target protein)
- Pathways
- Chromatin Binding, Maintenance of Protein Location
-