DAAM1 anticorps (Middle Region)
-
- Antigène Voir toutes DAAM1 Anticorps
- DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DAAM1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DAAM1 antibody was raised against the middle region of DAAM1
- Purification
- Affinity purified
- Immunogène
- DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV
- Top Product
- Discover our top product DAAM1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DAAM1 Blocking Peptide, catalog no. 33R-3460, is also available for use as a blocking control in assays to test for specificity of this DAAM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAAM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))
- Autre désignation
- DAAM1 (DAAM1 Produits)
- Synonymes
- anticorps 1700066F09Rik, anticorps 2310028E21Rik, anticorps AI503486, anticorps E130308H01, anticorps mKIAA0666, anticorps daam-1, anticorps xdaam1, anticorps daam1, anticorps DAAM1, anticorps DKFZp468D0524, anticorps daam1l, anticorps fc83b10, anticorps si:ch211-87i20.1, anticorps wu:fc83b10, anticorps dishevelled associated activator of morphogenesis 1, anticorps dishevelled associated activator of morphogenesis 1 S homeolog, anticorps dishevelled associated activator of morphogenesis 1a, anticorps dishevelled associated activator of morphogenesis 1b, anticorps DAAM1, anticorps Daam1, anticorps daam1.S, anticorps daam1a, anticorps daam1, anticorps daam1b
- Sujet
- The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.
- Poids moléculaire
- 123 kDa (MW of target protein)
- Pathways
- Signalisation WNT
-