STUB1 anticorps (N-Term)

N° du produit ABIN630820

Cet anticorps Lapin Polyclonal détecte spécifiquement STUB1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour STUB1 anticorps (N-Term) (ABIN630820)

Antigène: STUB1 (STIP1 Homology and U-Box Containing Protein 1 (STUB1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STUB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-STUB1 anticorps

Épitope: N-Term

Specificité: STUB1 antibody was raised against the N terminal of STUB1

Purification: Affinity purified

Immunogène: STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STUB1 Blocking Peptide, (ABIN5616448), is also available for use as a blocking control in assays to test for specificity of this STUB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STUB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STUB1

Antigène: STUB1 (STIP1 Homology and U-Box Containing Protein 1 (STUB1))

Autre désignation: STUB1

Sujet: STUB1 modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It has E3 ubiquitin-protein ligase activity and targets misfolded chaperone substrates towards proteasomal degradation. STUB1 mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process, Response to Water Deprivation