Peroxiredoxin 1 anticorps (N-Term)

N° du produit ABIN630826

Détail du produit anti-Peroxiredoxin 1 anticorps

Antigène: Peroxiredoxin 1 (PRDX1)

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peroxiredoxin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRDX1 antibody was raised against the N terminal of PRDX1

Purification: Affinity purified

Immunogène: PRDX1 antibody was raised using the N terminal of PRDX1 corresponding to a region with amino acids SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRDX1 Blocking Peptide, catalog no. 33R-8807, is also available for use as a blocking control in assays to test for specificity of this PRDX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Peroxiredoxin 1

Antigène: Peroxiredoxin 1 (PRDX1)

Autre désignation: PRDX1 (PRDX1 Produits)

Synonymes: anticorps MSP23, anticorps NKEF-A, anticorps NKEFA, anticorps PAG, anticorps PAGA, anticorps PAGB, anticorps PRX1, anticorps PRXI, anticorps TDPX2, anticorps NkefA, anticorps OSF-3, anticorps OSF3, anticorps Paga, anticorps PrdxI, anticorps PrxI, anticorps TDX2, anticorps TPxA, anticorps Tdpx2, anticorps prx1, anticorps Hbp23, anticorps MGC80194, anticorps MGC84820, anticorps PRDX1, anticorps msp23, anticorps nkefa, anticorps pag, anticorps paga, anticorps pagb, anticorps prx-1, anticorps prxi, anticorps tdpx2, anticorps hm:zehl0637, anticorps zgc:110343, anticorps TPX-2, anticorps peroxiredoxin 1, anticorps peroxiredoxin 1 S homeolog, anticorps peroxiredoxin-1 pseudogene, anticorps PRDX1, anticorps Prdx1, anticorps prdx1.S, anticorps prdx1, anticorps LOC100350232

Sujet: PRDX1 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Signalisation p53, EGFR Signaling Pathway, CXCR4-mediated Signaling Events