ACTN2 anticorps (N-Term)

N° du produit ABIN630832

Détail du produit anti-ACTN2 anticorps

Antigène: ACTN2 (Actinin, alpha 2 (ACTN2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Alpha Actinin 2 antibody was raised against the N terminal of ACTN2

Purification: Affinity purified

Immunogène: alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Alpha Actinin 2 Blocking Peptide, catalog no. 33R-6838, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTN2

Antigène: ACTN2 (Actinin, alpha 2 (ACTN2))

Autre désignation: alpha Actinin 2 (ACTN2 Produits)

Synonymes: anticorps MGC89234, anticorps ACTN2, anticorps 1110008F24Rik, anticorps CMD1AA, anticorps wu:fd44c03, anticorps zgc:123223, anticorps actinin alpha 2, anticorps actinin, alpha 2b, anticorps actinin alpha 2 S homeolog, anticorps actn2, anticorps ACTN2, anticorps Actn2, anticorps actn2b, anticorps actn2.S

Sujet: The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres.

Poids moléculaire: 104 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Skeletal Muscle Fiber Development, Negative Regulation of Transporter Activity