DNMT3B anticorps

N° du produit ABIN630856

Cet anticorps Lapin Polyclonal détecte spécifiquement DNMT3B dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour DNMT3B anticorps (ABIN630856)

Antigène: DNMT3B (DNA (Cytosine-5-)-Methyltransferase 3 beta (DNMT3B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNMT3B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DNMT3B anticorps

Purification: Affinity purified

Immunogène: DNMT3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNMT3B Blocking Peptide, (ABIN938993), is also available for use as a blocking control in assays to test for specificity of this DNMT3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNMT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNMT3B

Antigène: DNMT3B (DNA (Cytosine-5-)-Methyltransferase 3 beta (DNMT3B))

Autre désignation: DNMT3B

Sujet: DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

Poids moléculaire: 86 kDa (MW of target protein)