MAP3K1 anticorps (C-Term)

N° du produit ABIN630931

Cet anticorps Lapin Polyclonal détecte spécifiquement MAP3K1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour MAP3K1 anticorps (C-Term) (ABIN630931)

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP3K1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAP3K1 anticorps

Épitope: C-Term

Specificité: MAP3 K1 antibody was raised against the C terminal of MAP3 1

Purification: Affinity purified

Immunogène: MAP3 K1 antibody was raised using the C terminal of MAP3 1 corresponding to a region with amino acids LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP3K1 Blocking Peptide, (ABIN940346), is also available for use as a blocking control in assays to test for specificity of this MAP3K1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP3K1

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Autre désignation: MAP3K1

Sujet: MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin and many growth factors.

Poids moléculaire: 164 kDa (MW of target protein)

Pathways: Signalisation MAPK, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades