PARP2 anticorps

N° du produit ABIN631010

Détail du produit anti-PARP2 anticorps

Antigène: PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PARP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA

Information d'application

Indications d'application: WB: 1.6 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARP2 Blocking Peptide, catalog no. 33R-5123, is also available for use as a blocking control in assays to test for specificity of this PARP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARP2

Antigène: PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))

Autre désignation: PARP2 (PARP2 Produits)

Synonymes: anticorps ADPRT2, anticorps ADPRTL2, anticorps ADPRTL3, anticorps ARTD2, anticorps PARP-2, anticorps pADPRT-2, anticorps Adprt2, anticorps Adprtl2, anticorps Aspartl2, anticorps C78626, anticorps cb996, anticorps adprtl2, anticorps ADPRT-2, anticorps APP, anticorps ATPARP1, anticorps PARP1, anticorps POLY(ADP-RIBOSE) POLYMERASE, anticorps POLY(ADP-RIBOSE) POLYMERASE 1, anticorps PP, anticorps T14P8.19, anticorps T14P8_19, anticorps poly(ADP-ribose) polymerase, anticorps poly(ADP-ribose) polymerase 2, anticorps poly(ADP-ribose) polymerase 2, anticorps poly (ADP-ribose) polymerase family, member 2, anticorps poly (ADP-ribose) polymerase 2, anticorps poly(ADP-ribose) polymerase 2 S homeolog, anticorps poly(ADP-ribose) polymerase, anticorps PARP2, anticorps Parp2, anticorps parp2, anticorps parp2.S

Sujet: PARP2 contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of protein.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Réparation de l'ADN