ACO2 anticorps (Middle Region)

N° du produit ABIN631019

L’anticorps Lapin Polyclonal anti-ACO2 a été validé pour WB. Il convient pour détecter ACO2 dans des échantillons de Humain, Rat, Souris et C. elegans.

Aperçu rapide pour ACO2 anticorps (Middle Region) (ABIN631019)

Antigène: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Reactivité: Humain, Rat, Souris, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACO2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACO2 anticorps

Épitope: Middle Region

Specificité: ACO2 antibody was raised against the middle region of ACO2

Purification: Affinity purified

Immunogène: ACO2 antibody was raised using the middle region of ACO2 corresponding to a region with amino acids RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACO2 Blocking Peptide, (ABIN5611905), is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACO2

Antigène: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Autre désignation: ACO2

Sujet: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Poids moléculaire: 82 kDa (MW of target protein)