IDH1 anticorps

N° du produit ABIN631025

Détail du produit anti-IDH1 anticorps

Antigène: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IDH1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IDH1 Blocking Peptide, catalog no. 33R-6238, is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IDH1

Antigène: IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))

Autre désignation: IDH1 (IDH1 Produits)

Synonymes: anticorps IDCD, anticorps IDH, anticorps IDP, anticorps IDPC, anticorps PICD, anticorps NADP-CICDH, anticorps AI314845, anticorps AI788952, anticorps E030024J03Rik, anticorps Id-1, anticorps Idh-1, anticorps Idpc, anticorps cb876, anticorps fm90e09, anticorps im:7143416, anticorps wu:fm90e09, anticorps F23E12.180, anticorps F23E12_180, anticorps IDH-I, anticorps NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1, anticorps isocitrate dehydrogenase 1, anticorps isocitrate dehydrogenase I, anticorps isocitrate dehydrogenase (NADP(+)) 1, cytosolic, anticorps isocitrate dehydrogenase 1 (NADP+), soluble, anticorps isocitrate dehydrogenase 1 (NADP+) L homeolog, anticorps isocitrate dehydrogenase 1, anticorps IDH1, anticorps Idh1, anticorps idh1.L, anticorps idh1

Sujet: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: L'effet Warburg