PDK3 anticorps (Middle Region)

N° du produit ABIN631033

Cet anticorps Lapin Polyclonal détecte spécifiquement PDK3 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PDK3 anticorps (Middle Region) (ABIN631033)

Antigène: PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDK3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDK3 anticorps

Épitope: Middle Region

Specificité: PDK3 antibody was raised against the middle region of PDK3

Purification: Affinity purified

Immunogène: PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDK3 Blocking Peptide, (ABIN939608), is also available for use as a blocking control in assays to test for specificity of this PDK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDK3

Antigène: PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))

Autre désignation: PDK3

Sujet: PDK3 belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. PDK3 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, L'effet Warburg