PDK3 anticorps (Middle Region)

N° du produit ABIN631033

Détail du produit anti-PDK3 anticorps

Antigène: PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDK3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PDK3 antibody was raised against the middle region of PDK3

Purification: Affinity purified

Immunogène: PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDK3 Blocking Peptide, catalog no. 33R-4222, is also available for use as a blocking control in assays to test for specificity of this PDK3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDK3

Antigène: PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))

Autre désignation: PDK3 (PDK3 Produits)

Synonymes: anticorps pdk3, anticorps PDK3, anticorps 2610001M10Rik, anticorps AI035637, anticorps zgc:158702, anticorps pyruvate dehydrogenase kinase 3, anticorps pyruvate dehydrogenase kinase, isozyme 3a, anticorps pyruvate dehydrogenase kinase, isoenzyme 3, anticorps fragile site, 5-azacytidine type, common, fra(1)(q12), anticorps pyruvate dehydrogenase kinase, isozyme 3b, anticorps PDK3, anticorps Pdk3, anticorps pdk3a, anticorps pdk3, anticorps FRA1J, anticorps pdk3b

Sujet: PDK3 belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. PDK3 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, L'effet Warburg