PCCA anticorps (N-Term)

N° du produit ABIN631082

L’anticorps Lapin Polyclonal anti-PCCA a été validé pour WB. Il convient pour détecter PCCA dans des échantillons de Humain.

Aperçu rapide pour PCCA anticorps (N-Term) (ABIN631082)

Antigène: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCCA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCCA anticorps

Épitope: N-Term

Specificité: PCCA antibody was raised against the N terminal of PCCA

Purification: Affinity purified

Immunogène: PCCA antibody was raised using the N terminal of PCCA corresponding to a region with amino acids LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCCA Blocking Peptide, (ABIN5615238), is also available for use as a blocking control in assays to test for specificity of this PCCA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCCA

Antigène: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Autre désignation: PCCA

Sujet: PCCA is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA is the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia.

Poids moléculaire: 75 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process