EIF2C3 anticorps (N-Term)

N° du produit ABIN631112

L’anticorps Lapin Polyclonal anti-EIF2C3 a été validé pour WB. Il convient pour détecter EIF2C3 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour EIF2C3 anticorps (N-Term) (ABIN631112)

Antigène: EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2C3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EIF2C3 anticorps

Épitope: N-Term

Specificité: EIF2 C3 antibody was raised against the N terminal of EIF2 3

Purification: Affinity purified

Immunogène: EIF2 C3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2C3 Blocking Peptide, (ABIN5613324), is also available for use as a blocking control in assays to test for specificity of this EIF2C3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2C3

Antigène: EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))

Autre désignation: EIF2C3

Sujet: EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway