EIF2C3 anticorps (N-Term)

N° du produit ABIN631112

Détail du produit anti-EIF2C3 anticorps

Antigène: EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2C3 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF2 C3 antibody was raised against the N terminal of EIF2 3

Purification: Affinity purified

Immunogène: EIF2 C3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2C3 Blocking Peptide, catalog no. 33R-5810, is also available for use as a blocking control in assays to test for specificity of this EIF2C3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2C3

Antigène: EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))

Autre désignation: EIF2C3 (EIF2C3 Produits)

Synonymes: anticorps EIF2C3, anticorps Eif2c3, anticorps Argonaute3, anticorps ago3, anticorps eif2c3, anticorps eif2c3b, anticorps si:dkey-3n22.3, anticorps AW048688, anticorps C130014L07Rik, anticorps ARGONAUTE 3, anticorps T19E23.8, anticorps T19E23_8, anticorps argonaute 3, RISC catalytic component, anticorps argonaute RISC catalytic component 3b, anticorps argonaute RISC catalytic subunit 3, anticorps argonaute RISC catalytic component 3, anticorps ARGONAUTE 3, anticorps AGO3, anticorps Ago3, anticorps ago3b

Sujet: EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway