Adipsin anticorps (N-Term)

N° du produit ABIN631122

Cet anticorps anti-Adipsin est un anticorps Lapin Polyclonal détectant Adipsin dans WB. Adapté pour Drosophila melanogaster.

Aperçu rapide pour Adipsin anticorps (N-Term) (ABIN631122)

Antigène: Adipsin (CFD) (Complement Factor D (CFD))

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adipsin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Adipsin anticorps

Épitope: N-Term

Specificité: EVE antibody was raised against the N terminal Of Eve

Purification: Affinity purified

Immunogène: EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EVE Blocking Peptide, (ABIN5613417), is also available for use as a blocking control in assays to test for specificity of this EVE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Adipsin

Antigène: Adipsin (CFD) (Complement Factor D (CFD))

Autre désignation: EVE

Sujet: Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation, involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Système du Complément