Adipsin anticorps (N-Term)

N° du produit ABIN631122

Détail du produit anti-Adipsin anticorps

Antigène: Adipsin (CFD) (Complement Factor D (CFD))

Épitope: N-Term

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adipsin est non-conjugé

Application: Western Blotting (WB)

Specificité: EVE antibody was raised against the N terminal Of Eve

Purification: Affinity purified

Immunogène: EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EVE Blocking Peptide, catalog no. 33R-6092, is also available for use as a blocking control in assays to test for specificity of this EVE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Adipsin

Antigène: Adipsin (CFD) (Complement Factor D (CFD))

Autre désignation: EVE (CFD Produits)

Synonymes: anticorps ADIPSIN, anticorps ADN, anticorps DF, anticorps PFD, anticorps Adn, anticorps Df, anticorps EVE, anticorps CFD, anticorps adipsin, anticorps pfd, anticorps cfdl, anticorps wu:fb61f12, anticorps zgc:109940, anticorps 10.5, anticorps 10.9, anticorps 14.10, anticorps 20.35, anticorps CG2328, anticorps Dmel\\CG2328, anticorps E(eve), anticorps Eve, anticorps F, anticorps V, anticorps VI, anticorps eve2, anticorps even, anticorps l(2)46CFg, anticorps l(2)46CFh, anticorps l(2)46CFj, anticorps l(2)46CFp, anticorps l(2)46Ce, anticorps l(2)46Cg, anticorps complement factor D, anticorps complement factor D (adipsin), anticorps complement factor D (adipsin) L homeolog, anticorps even skipped, anticorps CFD, anticorps Cfd, anticorps cfd.L, anticorps cfd, anticorps eve

Sujet: Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation, involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Système du Complément