AKAP5 anticorps

N° du produit ABIN631131

Détail du produit anti-AKAP5 anticorps

Antigène: AKAP5 (A Kinase (PRKA) Anchor Protein 5 (AKAP5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKAP5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AKAP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKAP5 Blocking Peptide, catalog no. 33R-4603, is also available for use as a blocking control in assays to test for specificity of this AKAP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKAP5

Antigène: AKAP5 (A Kinase (PRKA) Anchor Protein 5 (AKAP5))

Autre désignation: AKAP5 (AKAP5 Produits)

Synonymes: anticorps AKAP5, anticorps AKAP75, anticorps AKAP79, anticorps H21, anticorps AKAP, anticorps P75, anticorps 3526401B18Rik, anticorps AKAP 150, anticorps AKAP-5, anticorps AKAP150, anticorps BB098886, anticorps Gm258, anticorps P150, anticorps Akap79, anticorps A kinase (PRKA) anchor protein 5, anticorps A-kinase anchoring protein 5, anticorps AKAP5, anticorps Akap5

Classe de substances: Viral Protein

Sujet: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP5 is a member of the AKAP family. It binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: cAMP Metabolic Process