SNAP23 anticorps (N-Term)

N° du produit ABIN631139

L’anticorps Lapin Polyclonal anti-SNAP23 a été validé pour WB. Il convient pour détecter SNAP23 dans des échantillons de Humain.

Aperçu rapide pour SNAP23 anticorps (N-Term) (ABIN631139)

Antigène: SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNAP23 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SNAP23 anticorps

Épitope: N-Term

Specificité: SNAP23 antibody was raised against the N terminal of SNAP23

Purification: Affinity purified

Immunogène: SNAP23 antibody was raised using the N terminal of SNAP23 corresponding to a region with amino acids GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNAP23 Blocking Peptide, (ABIN938718), is also available for use as a blocking control in assays to test for specificity of this SNAP23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAP23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNAP23

Antigène: SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))

Autre désignation: SNAP23

Sujet: SNAP23 is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this genepecificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin.

Poids moléculaire: 23 kDa (MW of target protein)