TINF2 anticorps

N° du produit ABIN631193

L’anticorps anti-TINF2 Polyclonal Lapin est utilisé pour la détection de TINF2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour TINF2 anticorps (ABIN631193)

Antigène: TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TINF2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TINF2 anticorps

Purification: Affinity purified

Immunogène: TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TINF2 Blocking Peptide, (ABIN5616612), is also available for use as a blocking control in assays to test for specificity of this TINF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TINF2

Antigène: TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))

Autre désignation: TINF2

Sujet: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends, without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Cycle Cellulaire, Telomere Maintenance, Regulation of Carbohydrate Metabolic Process