UBR2 anticorps (C-Term)

N° du produit ABIN631224

Cet anticorps anti-UBR2 Polyclonal Lapin (ABIN631224) détecte spécifiquement UBR2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour UBR2 anticorps (C-Term) (ABIN631224)

Antigène: UBR2 (Ubiquitin Protein Ligase E3 Component N-Recognin 2 (UBR2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBR2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBR2 anticorps

Épitope: C-Term

Specificité: UBR2 antibody was raised against the C terminal of UBR2

Purification: Affinity purified

Immunogène: UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBR2 Blocking Peptide, (ABIN5616890), is also available for use as a blocking control in assays to test for specificity of this UBR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBR2

Antigène: UBR2 (Ubiquitin Protein Ligase E3 Component N-Recognin 2 (UBR2))

Autre désignation: UBR2

Sujet: Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognise the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron.

Poids moléculaire: 200 kDa (MW of target protein)