Cortactin anticorps (N-Term)

N° du produit ABIN631298

L’anticorps Lapin Polyclonal anti-Cortactin a été validé pour WB. Il convient pour détecter Cortactin dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Cortactin anticorps (N-Term) (ABIN631298)

Antigène: Cortactin (CTTN)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cortactin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Cortactin anticorps

Épitope: N-Term

Specificité: Cortactin antibody was raised against the N terminal of CTTN

Purification: Affinity purified

Immunogène: Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cortactin Blocking Peptide, (ABIN939797), is also available for use as a blocking control in assays to test for specificity of this Cortactin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cortactin

Antigène: Cortactin (CTTN)

Autre désignation: Cortactin

Sujet: CTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Signalisation MAPK