Cortactin anticorps (N-Term)

N° du produit ABIN631298

Détail du produit anti-Cortactin anticorps

Antigène: Cortactin (CTTN)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cortactin est non-conjugé

Application: Western Blotting (WB)

Specificité: Cortactin antibody was raised against the N terminal of CTTN

Purification: Affinity purified

Immunogène: Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cortactin Blocking Peptide, catalog no. 33R-4411, is also available for use as a blocking control in assays to test for specificity of this Cortactin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cortactin

Antigène: Cortactin (CTTN)

Autre désignation: Cortactin (CTTN Produits)

Synonymes: anticorps EMS1, anticorps 1110020L01Rik, anticorps Ems1, anticorps Cttnb, anticorps CG3637, anticorps Dmel\CG3637, anticorps cortactin, anticorps cttn, anticorps CTTN1, anticorps P85.25, anticorps Cttn, anticorps ems1, anticorps CTTN, anticorps cortactin, anticorps CG3637 gene product from transcript CG3637-RD, anticorps cortactin S homeolog, anticorps cortactin L homeolog, anticorps src substrate cortactin, anticorps Src substrate cortactin, anticorps CTTN, anticorps Cttn, anticorps Cortactin, anticorps cttn.S, anticorps cttn.L, anticorps cttn, anticorps CpipJ_CPIJ006351, anticorps Bm1_57220, anticorps LOC100533277

Sujet: CTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Signalisation MAPK