HECTD2 anticorps (C-Term)

N° du produit ABIN631394

L’anticorps Lapin Polyclonal anti-HECTD2 a été validé pour WB. Il convient pour détecter HECTD2 dans des échantillons de Humain et Souris.

Aperçu rapide pour HECTD2 anticorps (C-Term) (ABIN631394)

Antigène: HECTD2 (HECT Domain Containing 2 (HECTD2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HECTD2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HECTD2 anticorps

Épitope: C-Term

Specificité: HECTD2 antibody was raised against the C terminal of HECTD2

Purification: Affinity purified

Immunogène: HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HECTD2 Blocking Peptide, (ABIN5613982), is also available for use as a blocking control in assays to test for specificity of this HECTD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECTD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HECTD2

Antigène: HECTD2 (HECT Domain Containing 2 (HECTD2))

Autre désignation: HECTD2

Sujet: HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Poids moléculaire: 88 kDa (MW of target protein)