ATG4A anticorps

N° du produit ABIN631439

L’anticorps anti-ATG4A Polyclonal Lapin est utilisé pour la détection de ATG4A dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour ATG4A anticorps (ABIN631439)

Antigène: ATG4A (Autophagy related 4A Cysteine Peptidase (ATG4A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATG4A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ATG4A anticorps

Purification: Affinity purified

Immunogène: ATG4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATG4A Blocking Peptide, (ABIN937239), is also available for use as a blocking control in assays to test for specificity of this ATG4A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATG4A

Antigène: ATG4A (Autophagy related 4A Cysteine Peptidase (ATG4A))

Autre désignation: ATG4A

Sujet: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Autophagy