GCLC anticorps (N-Term)
-
- Antigène Voir toutes GCLC Anticorps
- GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GCLC est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GCLC antibody was raised against the N terminal of GCLC
- Purification
- Affinity purified
- Immunogène
- GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
- Top Product
- Discover our top product GCLC Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GCLC Blocking Peptide, catalog no. 33R-9653, is also available for use as a blocking control in assays to test for specificity of this GCLC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))
- Autre désignation
- GCLC (GCLC Produits)
- Synonymes
- anticorps GCLC, anticorps gclc, anticorps MGC146287, anticorps 2259, anticorps CG2259, anticorps DmGCLC, anticorps DmGCS, anticorps DmGCSh, anticorps Dmel\\CG2259, anticorps GCL, anticorps GCLc, anticorps GCSh, anticorps Gcs, anticorps Gcsh, anticorps DDBDRAFT_0186120, anticorps DDBDRAFT_0231403, anticorps DDB_0186120, anticorps DDB_0231403, anticorps GCS, anticorps GLCL, anticorps GLCLC, anticorps D9Wsu168e, anticorps GLCL-H, anticorps Ggcs-hs, anticorps Glclc, anticorps cb1049, anticorps fe36e11, anticorps wu:fe36e11, anticorps glutamate-cysteine ligase catalytic subunit, anticorps glutamate-cysteine ligase, catalytic subunit, anticorps Glutamate-cysteine ligase catalytic subunit, anticorps gamma glutamylcysteine synthetase, anticorps glutamate-cysteine ligase, catalytic subunit L homeolog, anticorps glutamate-cysteine ligase, catalytic subunit S homeolog, anticorps gamma-glutamylcysteine synthetase, anticorps GCLC, anticorps gclc, anticorps Gclc, anticorps LbGCS, anticorps gcsA, anticorps gclc.L, anticorps gclc.S, anticorps GSH1
- Sujet
- Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.
- Poids moléculaire
- 73 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-