GAPDHS anticorps (N-Term)

N° du produit ABIN631607

Détail du produit anti-GAPDHS anticorps

Antigène: GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAPDHS est non-conjugé

Application: Western Blotting (WB)

Specificité: GAPDHS antibody was raised against the N terminal of GAPDHS

Purification: Affinity purified

Immunogène: GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAPDHS Blocking Peptide, catalog no. 33R-7075, is also available for use as a blocking control in assays to test for specificity of this GAPDHS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDHS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GAPDHS

Antigène: GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))

Autre désignation: GAPDHS (GAPDHS Produits)

Synonymes: anticorps GAPDS, anticorps GAPDHS, anticorps GAPD2, anticorps GAPDH-2, anticorps HSD-35, anticorps Gapd-s, anticorps Gapds, anticorps gapdh-2, anticorps cb350, anticorps fb71f08, anticorps fk58c09, anticorps g3pdh, anticorps gapdh, anticorps gapds, anticorps wu:fb71f08, anticorps wu:fk58c09, anticorps zgc:76908, anticorps glyceraldehyde-3-phosphate dehydrogenase, spermatogenic, anticorps GAPDHS, anticorps Gapdhs, anticorps gapdhs

Sujet: GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process