PRAS40 anticorps

N° du produit ABIN631641

Détail du produit anti-PRAS40 anticorps

Antigène: PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRAS40 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AKT1 S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKT1S1 Blocking Peptide, catalog no. 33R-4654, is also available for use as a blocking control in assays to test for specificity of this AKT1S1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRAS40

Antigène: PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))

Autre désignation: AKT1S1 (AKT1S1 Produits)

Synonymes: anticorps MGC81452, anticorps lobe, anticorps pras40, anticorps fb34a04, anticorps wu:fb34a04, anticorps Lobe, anticorps PRAS40, anticorps 1110012J22Rik, anticorps AI227026, anticorps Lobel, anticorps AKT1 substrate 1 (proline rich) S homeolog, anticorps AKT1 substrate 1, anticorps AKT1 substrate 1 (proline rich), anticorps AKT1 substrate 1 (proline-rich), anticorps akt1s1.S, anticorps AKT1S1, anticorps akt1s1, anticorps Akt1s1

Sujet: AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Cell Size, Autophagy, BCR Signaling, L'effet Warburg