SENP1 anticorps (Middle Region)

N° du produit ABIN631695

Cet anticorps anti-SENP1 est un anticorps Lapin Polyclonal détectant SENP1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SENP1 anticorps (Middle Region) (ABIN631695)

Antigène: SENP1 (SUMO1/sentrin Specific Peptidase 1 (SENP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SENP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SENP1 anticorps

Épitope: Middle Region

Specificité: SENP1 antibody was raised against the middle region of SENP1

Purification: Affinity purified

Immunogène: SENP1 antibody was raised using the middle region of SENP1 corresponding to a region with amino acids PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SENP1 Blocking Peptide, (ABIN5616041), is also available for use as a blocking control in assays to test for specificity of this SENP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SENP1

Antigène: SENP1 (SUMO1/sentrin Specific Peptidase 1 (SENP1))

Autre désignation: SENP1

Sujet: The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.

Poids moléculaire: 73 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity