GPD1L anticorps (Middle Region)

N° du produit ABIN631705

Détail du produit anti-GPD1L anticorps

Antigène: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPD1L est non-conjugé

Application: Western Blotting (WB)

Specificité: GPD1 L antibody was raised against the middle region of GPD1

Purification: Affinity purified

Immunogène: GPD1 L antibody was raised using the middle region of GPD1 corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPD1L Blocking Peptide, catalog no. 33R-2538, is also available for use as a blocking control in assays to test for specificity of this GPD1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPD1L

Antigène: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Autre désignation: GPD1L (GPD1L Produits)

Synonymes: anticorps wu:fi13g03, anticorps wu:fi45b08, anticorps zgc:92580, anticorps GPD1-L, anticorps 2210409H23Rik, anticorps D9Ertd660e, anticorps RGD1560123, anticorps glycerol-3-phosphate dehydrogenase 1 like, anticorps glycerol-3-phosphate dehydrogenase 1-like, anticorps glycerol-3-phosphate dehydrogenase 1 like L homeolog, anticorps gpd1l, anticorps GPD1L, anticorps gpd1l.L, anticorps Gpd1l

Sujet: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Poids moléculaire: 38 kDa (MW of target protein)