ELP2 anticorps

N° du produit ABIN631751

L’anticorps anti-ELP2 Polyclonal Lapin est utilisé pour la détection de ELP2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour ELP2 anticorps (ABIN631751)

Antigène: ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ELP2 anticorps

Purification: Affinity purified

Immunogène: ELP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELP2 Blocking Peptide, (ABIN937775), is also available for use as a blocking control in assays to test for specificity of this ELP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELP2

Antigène: ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))

Autre désignation: ELP2

Sujet: ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus