Kallikrein 13 anticorps (Middle Region)

N° du produit ABIN631838

Détail du produit anti-Kallikrein 13 anticorps

Antigène: Kallikrein 13 (KLK13) (Kallikrein-Related Peptidase 13 (KLK13))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Kallikrein 13 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLK13 antibody was raised against the middle region of KLK13

Purification: Affinity purified

Immunogène: KLK13 antibody was raised using the middle region of KLK13 corresponding to a region with amino acids VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLK13 Blocking Peptide, catalog no. 33R-9689, is also available for use as a blocking control in assays to test for specificity of this KLK13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Kallikrein 13

Antigène: Kallikrein 13 (KLK13) (Kallikrein-Related Peptidase 13 (KLK13))

Autre désignation: KLK13 (KLK13 Produits)

Synonymes: anticorps KLK-L4, anticorps KLKL4, anticorps Egfbp-2, anticorps mGk-13, anticorps kallikrein related peptidase 13, anticorps kallikrein related-peptidase 13, anticorps KLK13, anticorps Klk13

Sujet: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Système du Complément