MYL3/CMLC1 anticorps (N-Term)

N° du produit ABIN631908

Détail du produit anti-MYL3/CMLC1 anticorps

Antigène: MYL3/CMLC1 (MYL3) (Myosin, Light Chain 3 (MYL3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYL3/CMLC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MYL3 antibody was raised against the N terminal of MYL3

Purification: Affinity purified

Immunogène: MYL3 antibody was raised using the N terminal of MYL3 corresponding to a region with amino acids VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYL3 Blocking Peptide, catalog no. 33R-9494, is also available for use as a blocking control in assays to test for specificity of this MYL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYL3/CMLC1

Antigène: MYL3/CMLC1 (MYL3) (Myosin, Light Chain 3 (MYL3))

Autre désignation: MYL3 (MYL3 Produits)

Synonymes: anticorps CMD1S, anticorps CMH1, anticorps MPD1, anticorps MYHCB, anticorps SPMD, anticorps SPMM, anticorps B-MHC, anticorps MyHC-I, anticorps Myhc-b, anticorps Myhcb, anticorps beta-MHC, anticorps MLC1s, anticorps MLC1v, anticorps Mylc, anticorps VLC1, anticorps Mylc1v, anticorps CMH8, anticorps MLC1SB, anticorps MLC1V, anticorps mlc1v, anticorps myl3-a, anticorps myl3-b, anticorps myl3.L, anticorps zgc:103441, anticorps myosin heavy chain 7, anticorps myosin, heavy polypeptide 7, cardiac muscle, beta, anticorps myosin, light polypeptide 3, anticorps myosin light chain 3, anticorps myosin light chain 3 S homeolog, anticorps cardiac myosin light chain-1, anticorps MYH7, anticorps Myh7, anticorps Myl3, anticorps MYL3, anticorps myl3.S, anticorps cmlc1

Sujet: MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform.

Poids moléculaire: 22 kDa (MW of target protein)