FANCL anticorps (Middle Region)

N° du produit ABIN631983

Cet anticorps anti-FANCL Polyclonal Lapin (ABIN631983) détecte spécifiquement FANCL dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour FANCL anticorps (Middle Region) (ABIN631983)

Antigène: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FANCL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FANCL anticorps

Épitope: Middle Region

Specificité: FANCL antibody was raised against the middle region of FANCL

Purification: Affinity purified

Immunogène: FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FANCL Blocking Peptide, (ABIN936892), is also available for use as a blocking control in assays to test for specificity of this FANCL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FANCL

Antigène: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Autre désignation: FANCL

Sujet: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Réparation de l'ADN