FANCL anticorps (Middle Region)

N° du produit ABIN631983

Détail du produit anti-FANCL anticorps

Antigène: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FANCL est non-conjugé

Application: Western Blotting (WB)

Specificité: FANCL antibody was raised against the middle region of FANCL

Purification: Affinity purified

Immunogène: FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FANCL Blocking Peptide, catalog no. 33R-1506, is also available for use as a blocking control in assays to test for specificity of this FANCL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FANCL

Antigène: FANCL (Fanconi Anemia, Complementation Group L (FANCL))

Autre désignation: FANCL (FANCL Produits)

Synonymes: anticorps FAAP43, anticorps PHF9, anticorps POG, anticorps 2010322C19Rik, anticorps AW554273, anticorps B230118H11Rik, anticorps Phf9, anticorps Pog, anticorps gcd, anticorps Fanconi anemia complementation group L, anticorps Fanconi anemia, complementation group L, anticorps FANCL, anticorps Fancl

Sujet: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Réparation de l'ADN