AGO1 anticorps (N-Term)

N° du produit ABIN632044

Cet anticorps Lapin Polyclonal détecte spécifiquement AGO1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour AGO1 anticorps (N-Term) (ABIN632044)

Antigène: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGO1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AGO1 anticorps

Épitope: N-Term

Specificité: EIF2 C1 antibody was raised against the N terminal of EIF2 1

Purification: Affinity purified

Immunogène: EIF2 C1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2C1 Blocking Peptide, (ABIN5613323), is also available for use as a blocking control in assays to test for specificity of this EIF2C1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGO1

Antigène: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Autre désignation: EIF2C1

Sujet: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization