MAP3K14 anticorps (N-Term)

N° du produit ABIN632058

Détail du produit anti-MAP3K14 anticorps

Antigène: MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP3K14 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP3 K14 antibody was raised against the N terminal of MAP3 14

Purification: Affinity purified

Immunogène: MAP3 K14 antibody was raised using the N terminal of MAP3 14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP3K14 Blocking Peptide, catalog no. 33R-8382, is also available for use as a blocking control in assays to test for specificity of this MAP3K14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP3K14

Antigène: MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))

Autre désignation: MAP3K14 (MAP3K14 Produits)

Synonymes: anticorps FTDCR1B, anticorps HS, anticorps HSNIK, anticorps NIK, anticorps F23F1.4, anticorps F23F1_4, anticorps mitogen-activated protein kinase kinase kinase 14, anticorps Nik, anticorps aly, anticorps mitogen-activated protein kinase kinase kinase 14, anticorps MAP3K14, anticorps Map3k14, anticorps MAPKKK14

Sujet: This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.

Poids moléculaire: 104 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, TCR Signaling