ATG10 anticorps

N° du produit ABIN632157

Cet anticorps anti-ATG10 Polyclonal Lapin (ABIN632157) détecte spécifiquement ATG10 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ATG10 anticorps (ABIN632157)

Antigène: ATG10 (Autophagy Related 10 (ATG10))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATG10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ATG10 anticorps

Purification: Affinity purified

Immunogène: ATG10 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATG10 Blocking Peptide, (ABIN5612198), is also available for use as a blocking control in assays to test for specificity of this ATG10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATG10

Antigène: ATG10 (Autophagy Related 10 (ATG10))

Autre désignation: ATG10

Sujet: Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A), a homolog of yeast Apg8, to a membrane-bound form.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Autophagy