IFIT3 anticorps (N-Term)

N° du produit ABIN632163

Détail du produit anti-IFIT3 anticorps

Antigène: IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFIT3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: IFIT3 antibody was raised against the N terminal of IFIT3

Purification: Affinity purified

Immunogène: IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFIT3 Blocking Peptide, catalog no. 33R-1568, is also available for use as a blocking control in assays to test for specificity of this IFIT3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFIT3

Antigène: IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))

Autre désignation: IFIT3 (IFIT3 Produits)

Synonymes: anticorps DKFZp469G2233, anticorps CIG-49, anticorps GARG-49, anticorps IFI60, anticorps IFIT4, anticorps IRG2, anticorps ISG60, anticorps P60, anticorps RIG-G, anticorps Ifi49, anticorps P49, anticorps IFIT-3, anticorps interferon induced protein with tetratricopeptide repeats 3, anticorps interferon-induced protein with tetratricopeptide repeats 3, anticorps IFIT3, anticorps Ifit3

Sujet: IFIT3 is involved in protein binding.

Poids moléculaire: 56 kDa (MW of target protein)