COPS4 anticorps

N° du produit ABIN632182

Cet anticorps Lapin Polyclonal détecte spécifiquement COPS4 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour COPS4 anticorps (ABIN632182)

Antigène: COPS4 (COP9 Signalosome Subunit 4 (COPS4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COPS4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-COPS4 anticorps

Purification: Affinity purified

Immunogène: COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COPS4 Blocking Peptide, (ABIN936117), is also available for use as a blocking control in assays to test for specificity of this COPS4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COPS4

Antigène: COPS4 (COP9 Signalosome Subunit 4 (COPS4))

Autre désignation: COPS4

Sujet: COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Cycle Cellulaire