RPS6KB1 anticorps (N-Term)

N° du produit ABIN632265

Cet anticorps anti-RPS6KB1 est un anticorps Lapin Polyclonal détectant RPS6KB1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RPS6KB1 anticorps (N-Term) (ABIN632265)

Antigène: RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS6KB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPS6KB1 anticorps

Épitope: N-Term

Specificité: RPS6 KB1 antibody was raised against the N terminal of RPS6 B1

Purification: Affinity purified

Immunogène: RPS6 KB1 antibody was raised using the N terminal of RPS6 B1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS6KB1 Blocking Peptide, (ABIN5615952), is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 B1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS6KB1

Antigène: RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))

Autre désignation: RPS6KB1

Sujet: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Signalisation RTK, AMPK Signaling, Regulation of Cell Size, Skeletal Muscle Fiber Development, Feeding Behaviour, G-protein mediated Events, Smooth Muscle Cell Migration, Interaction of EGFR with phospholipase C-gamma, L'effet Warburg