RPS6KB1 anticorps (N-Term)
-
- Antigène Voir toutes RPS6KB1 Anticorps
- RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPS6KB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPS6 KB1 antibody was raised against the N terminal of RPS6 B1
- Purification
- Affinity purified
- Immunogène
- RPS6 KB1 antibody was raised using the N terminal of RPS6 B1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL
- Top Product
- Discover our top product RPS6KB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPS6KB1 Blocking Peptide, catalog no. 33R-6382, is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 B1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))
- Autre désignation
- RPS6KB1 (RPS6KB1 Produits)
- Synonymes
- anticorps PS6K, anticorps S6K, anticorps S6K-beta-1, anticorps S6K1, anticorps STK14A, anticorps p70 S6KA, anticorps p70(S6K)-alpha, anticorps p70-S6K, anticorps p70-alpha, anticorps 10539, anticorps 7084, anticorps CG10539, anticorps DS6K, anticorps Dmel\\CG10539, anticorps Dp70S6k, anticorps Dp70[s6k], anticorps Dp70s6k, anticorps S6k, anticorps dS6K, anticorps dS6k, anticorps dp70[S6k], anticorps dp70s6k, anticorps dps6k, anticorps ds6k, anticorps fs(3)07084, anticorps l(3)07084, anticorps p70 S6K, anticorps p70/S6K, anticorps p70S6K, anticorps p70[S6 kinase], anticorps p70[S6K], anticorps p70[S6k], anticorps p70[S6kinase], anticorps p70s6K, anticorps s6k, anticorps s6k11, anticorps 2610318I15Rik, anticorps 4732464A07Rik, anticorps 70kDa, anticorps AA959758, anticorps AI256796, anticorps AI314060, anticorps p70/85s6k, anticorps p70s6k, anticorps p70s6k-A, anticorps p70-s6k, anticorps ps6k, anticorps rps6kb1, anticorps rps6kb1-A, anticorps s6K1, anticorps stk14a, anticorps fc51h01, anticorps wu:fc51h01, anticorps zgc:55713, anticorps ribosomal protein S6 kinase B1, anticorps Ribosomal protein S6 kinase, anticorps ribosomal protein S6 kinase, polypeptide 1, anticorps ribosomal protein S6 kinase B1 L homeolog, anticorps ribosomal protein S6 kinase B1 S homeolog, anticorps ribosomal protein S6 kinase b, polypeptide 1b, anticorps RPS6KB1, anticorps S6k, anticorps Rps6kb1, anticorps rps6kb1.L, anticorps rps6kb1.S, anticorps rps6kb1b
- Sujet
- This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.
- Poids moléculaire
- 59 kDa (MW of target protein)
- Pathways
- Signalisation PI3K-Akt, Signalisation RTK, AMPK Signaling, Regulation of Cell Size, Skeletal Muscle Fiber Development, Feeding Behaviour, G-protein mediated Events, Smooth Muscle Cell Migration, Interaction of EGFR with phospholipase C-gamma, L'effet Warburg
-