Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

RPS6KB1 anticorps (N-Term)

RPS6KB1 Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN632265
  • Antigène Voir toutes RPS6KB1 Anticorps
    RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))
    Épitope
    • 28
    • 25
    • 21
    • 19
    • 18
    • 16
    • 16
    • 16
    • 15
    • 15
    • 15
    • 15
    • 14
    • 13
    • 12
    • 11
    • 10
    • 8
    • 8
    • 8
    • 8
    • 6
    • 5
    • 5
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivité
    • 351
    • 261
    • 258
    • 57
    • 24
    • 23
    • 20
    • 19
    • 11
    • 9
    • 9
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    Humain, Souris, Rat
    Hôte
    • 330
    • 34
    • 4
    • 2
    Lapin
    Clonalité
    • 332
    • 38
    Polyclonal
    Conjugué
    • 172
    • 23
    • 17
    • 15
    • 15
    • 15
    • 15
    • 15
    • 15
    • 15
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 6
    Cet anticorp RPS6KB1 est non-conjugé
    Application
    • 291
    • 143
    • 104
    • 94
    • 91
    • 74
    • 66
    • 32
    • 24
    • 20
    • 16
    • 8
    • 7
    • 4
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Specificité
    RPS6 KB1 antibody was raised against the N terminal of RPS6 B1
    Purification
    Affinity purified
    Immunogène
    RPS6 KB1 antibody was raised using the N terminal of RPS6 B1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL
    Top Product
    Discover our top product RPS6KB1 Anticorps primaire
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    RPS6KB1 Blocking Peptide, catalog no. 33R-6382, is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 B1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))
    Autre désignation
    RPS6KB1 (RPS6KB1 Produits)
    Synonymes
    anticorps PS6K, anticorps S6K, anticorps S6K-beta-1, anticorps S6K1, anticorps STK14A, anticorps p70 S6KA, anticorps p70(S6K)-alpha, anticorps p70-S6K, anticorps p70-alpha, anticorps 10539, anticorps 7084, anticorps CG10539, anticorps DS6K, anticorps Dmel\\CG10539, anticorps Dp70S6k, anticorps Dp70[s6k], anticorps Dp70s6k, anticorps S6k, anticorps dS6K, anticorps dS6k, anticorps dp70[S6k], anticorps dp70s6k, anticorps dps6k, anticorps ds6k, anticorps fs(3)07084, anticorps l(3)07084, anticorps p70 S6K, anticorps p70/S6K, anticorps p70S6K, anticorps p70[S6 kinase], anticorps p70[S6K], anticorps p70[S6k], anticorps p70[S6kinase], anticorps p70s6K, anticorps s6k, anticorps s6k11, anticorps 2610318I15Rik, anticorps 4732464A07Rik, anticorps 70kDa, anticorps AA959758, anticorps AI256796, anticorps AI314060, anticorps p70/85s6k, anticorps p70s6k, anticorps p70s6k-A, anticorps p70-s6k, anticorps ps6k, anticorps rps6kb1, anticorps rps6kb1-A, anticorps s6K1, anticorps stk14a, anticorps fc51h01, anticorps wu:fc51h01, anticorps zgc:55713, anticorps ribosomal protein S6 kinase B1, anticorps Ribosomal protein S6 kinase, anticorps ribosomal protein S6 kinase, polypeptide 1, anticorps ribosomal protein S6 kinase B1 L homeolog, anticorps ribosomal protein S6 kinase B1 S homeolog, anticorps ribosomal protein S6 kinase b, polypeptide 1b, anticorps RPS6KB1, anticorps S6k, anticorps Rps6kb1, anticorps rps6kb1.L, anticorps rps6kb1.S, anticorps rps6kb1b
    Sujet
    This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.
    Poids moléculaire
    59 kDa (MW of target protein)
    Pathways
    Signalisation PI3K-Akt, Signalisation RTK, AMPK Signaling, Regulation of Cell Size, Skeletal Muscle Fiber Development, Feeding Behaviour, G-protein mediated Events, Smooth Muscle Cell Migration, Interaction of EGFR with phospholipase C-gamma, L'effet Warburg
Vous êtes ici:
Support technique