FAS anticorps

N° du produit ABIN632316

Cet anticorps anti-FAS Polyclonal Lapin (ABIN632316) détecte spécifiquement FAS dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour FAS anticorps (ABIN632316)

Antigène: FAS (TNF Receptor Superfamily, Member 6 (FAS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAS anticorps

Purification: Affinity purified

Immunogène: FAS antibody was raised using a synthetic peptide corresponding to a region with amino acids KKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAS Blocking Peptide, (ABIN939841), is also available for use as a blocking control in assays to test for specificity of this FAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAS

Antigène: FAS (TNF Receptor Superfamily, Member 6 (FAS))

Autre désignation: FAS

Sujet: FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Signalisation p53, Apoptose, Production of Molecular Mediator of Immune Response, Positive Regulation of Endopeptidase Activity